Protein coding transcript 132

• Transcript: Ll_transcript_458894
• CDS coordinates: 3-464 (+)
• Peptide sequence: CSGLRSTTESTFVPVRLRRLSRFSGVVPHYLNMTTKLAPKVRLNDGNEIPVLGLGTWKSKPGEVTEAVKAAIDAGYRHIDGAHVYENEKEVGAGIKAKIDEGVVKREDLFITSKIWNAYHKPDLVVGACKKTLADLGLEYLDLYLVHWPMAFKE
• ORF Type: internal

Annotations of Ll_transcript_458894

• Blastp: 1,5-anhydro-D-fructose reductase from Sus with 68.87% of identity
• Blastx: 1,5-anhydro-D-fructose reductase from Sus with 68.87% of identity
• Eggnog: reductase(COG0656)
• Kegg: Link to kegg annotations (100738746)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004509601.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;