Protein coding transcript 132000

• Transcript: Ll_transcript_271274
• CDS coordinates: 211-822 (+)
• Peptide sequence: MSHNNPISIPLSQVTMEPKRLISTLLLLLLITMGSSSLPTNPTQRVHVPCKRLVFYFHDIIYNGHNFKNATSTIVGAPSWANKTILANQNHFGDLVIFDDPITLDNNLHSPPVGRAQGFYFYDKKEIFTSWLSFSFVFNSTHHKGTLNFAGADPLMNKTRDISVIGGTGEFFMTRGVATLSTDAFEGEVYFRLRVDINLFECW*
• ORF Type: complete

Annotations of Ll_transcript_271274

• Blastp: Disease resistance response protein 206 from Pisum with 61.96% of identity
• Blastx: Disease resistance response protein 206 from Pisum with 66.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422681.1)
• Pfam: Dirigent-like protein (PF03018.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;