Protein coding transcript 132005

• Transcript: Ll_transcript_271307
• CDS coordinates: 2-388 (+)
• Peptide sequence: ENVDHKLKFRSKKGQLPFIELNGEEIADSSIIIKELAERFEKDLDKDLDNEQKNVAYALTSMIENHLLWVVMWWRTKFTDDVIKGYHVSLQHQLGSKIPNGILNFFFKFTYGRKGAKKVKAQGMGVHKA
• ORF Type: internal

Annotations of Ll_transcript_271307

• Blastp: Failed axon connections from Sophophora with 65.91% of identity
• Blastx: Failed axon connections from Sophophora with 65.91% of identity
• Eggnog: failed axon connections homolog (Drosophila)(ENOG4111HSJ)
• Kegg: Link to kegg annotations (Dmel_CG4609)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004500926.1)
• Pfam: Glutathione S-transferase N-terminal domain (PF17172.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;