Transcript | Ll_transcript_271307 |
---|---|
CDS coordinates | 2-388 (+) |
Peptide sequence | ENVDHKLKFRSKKGQLPFIELNGEEIADSSIIIKELAERFEKDLDKDLDNEQKNVAYALTSMIENHLLWVVMWWRTKFTDDVIKGYHVSLQHQLGSKIPNGILNFFFKFTYGRKGAKKVKAQGMGVHKA |
ORF Type | internal |
Blastp | Failed axon connections from Sophophora with 65.91% of identity |
---|---|
Blastx | Failed axon connections from Sophophora with 65.91% of identity |
Eggnog | failed axon connections homolog (Drosophila)(ENOG4111HSJ) |
Kegg | Link to kegg annotations (Dmel_CG4609) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004500926.1) |
Pfam | Glutathione S-transferase N-terminal domain (PF17172.3) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer