Protein coding transcript 132006

• Transcript: Ll_transcript_271308
• CDS coordinates: 120-839 (+)
• Peptide sequence: MASEENNVTAESKAAEPAKPAEAPQDNKAEVEAAPAAPAAAEEAKKEEEAKEDKKEEEAAPPAPPKPTVHKPNFEQDVVYLYQFSRTPVLPSLSSFCLKVESFLRLAGIKYENVDHKLKFRSKKGQLPFIELNGEEIADSSIIIKELAERFEKDLDKDLDNEQKNVAYALTSMIENHLLWVVMWWRTKFTDDVIKGYHVSLQHQLGSKIPNGILNFFFKFTYGRKGAKKVKAQGMGVHKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_271308

• Blastp: Failed axon connections from Sophophora with 63.11% of identity
• Blastx: Failed axon connections from Sophophora with 68% of identity
• Eggnog: failed axon connections homolog (Drosophila)(ENOG4111HSJ)
• Kegg: Link to kegg annotations (Dmel_CG4609)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003603775.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF13417.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;