Protein coding transcript 132007

• Transcript: Ll_transcript_271268
• CDS coordinates: 1-630 (+)
• Peptide sequence: SNFGDSIPGYGGTGISVSSGDYGYKGQNSVGGPSGSDGNSEPEPFNFAYQVKDAPTNTDFKHEANSDGKRVTGAYSVLLPDGRNQVVTYVADENGYNAKINYEGEAKPQPSQPGSQGGYPSAPGFPSAAPSYPSAAPGYPSAAAPGYPSAAAPGYPSSASGFPSSAPGGYPSSAPSYPSSAPGFPSSAPSYPTGVKGSYAAPQPKNGGY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_271268

• Blastp: Pro-resilin from Sophophora with 52.94% of identity
• Blastx: Pro-resilin from Sophophora with 52.94% of identity
• Eggnog: Cuticular protein(ENOG41128ZS)
• Kegg: Link to kegg annotations (Dmel_CG15920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: Insect cuticle protein (PF00379.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;