Transcript | Ll_transcript_271337 |
---|---|
CDS coordinates | 1-960 (+) |
Peptide sequence | PQAMLGMDILCQAKSGMGKTAVFVLSTLQQLEVYESEVYALVLCHTRELAFQISKEFERFTKYLPAVKVSVFFGGVPITKDEDTLKNNKPHVVVGTPGRILELIRKKKLVLNNLKHFILDECDKMLEILHMRSDVQEIFKNTPFNKQVMMFSATLSKDIRPVCKKFMQQPLEVYVDDDAKLSLHGLQQYYVKLTEKEKNKKLLDLLDELEFNQVIIFVKSVQRCVVLTELLNEQNFPSVAMHGGMSQQDRLKFYQEFKDFQKRILVATNLFGRGMDIERVNIVINYDMPEDTDTYLHRVARAGRFGTKGLAITFICEETD |
ORF Type | internal |
Blastp | ATP-dependent RNA helicase DDX39A from Rattus with 75.94% of identity |
---|---|
Blastx | ATP-dependent RNA helicase DDX39A from Mus with 75.94% of identity |
Eggnog | purine NTP-dependent helicase activity(COG0513) |
Kegg | Link to kegg annotations (89827) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443384.1) |
Pfam | DEAD/DEAH box helicase (PF00270.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer