Protein coding transcript 132015

• Transcript: Ll_transcript_271252
• CDS coordinates: 3-455 (+)
• Peptide sequence: EIHKTIKKHNGLTYEAIMDMKYLNMCICETLRMYPVLPFLDRNTEMDYKIPGTDKILEKGTPVYIPMFGLHYDPEYFPDPKKFDPERFSDENVSKLTSFSYIPFGEGPRICIGERFGLLGTKVGLAKIISEYELIKIKETPVPLVYEQKSF
• ORF Type: internal

Annotations of Ll_transcript_271252

• Blastp: Cytochrome P450 6k1 from Blattella with 49.67% of identity
• Blastx: Cytochrome P450 6k1 from Blattella with 49.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013463948.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;