Protein coding transcript 132017

• Transcript: Ll_transcript_271311
• CDS coordinates: 395-709 (+)
• Peptide sequence: MLPAQDHKRIFDGDQGPNTGGMGAYCPCPLLNDEGLKFVEKEILQRTLDGFNKEGIKFVGVLYAGLMLTKEGPKVLEYNARFGDPETEVILPLLRSDLYTIMSSC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_271311

• Blastp: Trifunctional purine biosynthetic protein adenosine-3 from Sophophora with 65.71% of identity
• Blastx: Trifunctional purine biosynthetic protein adenosine-3 from Bos with 64.94% of identity
• Eggnog: phosphoribosylaminoimidazole synthetase(COG0150)
• Kegg: Link to kegg annotations (Dmel_CG31628)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012568295.1)
• Pfam: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain (PF01071.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;