Protein coding transcript 13202

• Transcript: Ll_transcript_400967
• CDS coordinates: 59-469 (+)
• Peptide sequence: MASKAALLLSLNILFFTVVSSTYVPCPPPPTPKHTSHPKAPSSNPAYPKKQPSCPKDTLKLGVCADVLGLVNAKLGKPPKVPCCSLIDGLANLEAAVCLCTALKANVLGINLNIPINLNLILNYCGKGVPNGFQCA*
• ORF Type: complete

Annotations of Ll_transcript_400967

• Blastp: 14 kDa proline-rich protein DC2.15 from Daucus sect. Daucus with 59.26% of identity
• Blastx: 14 kDa proline-rich protein DC2.15 from Daucus sect. Daucus with 72.29% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000401)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446705.1)
• Pfam: Hydrophobic seed protein (PF14547.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;