Protein coding transcript 132024

• Transcript: Ll_transcript_45907
• CDS coordinates: 40-441 (+)
• Peptide sequence: MEALQYTAREKKLQLVQIPIPKVSLPNQILIKVAYAGICGTDLHIIEGEFPCNKTNTFTLGHEFSGTVIEVGSNVSNFKKGDKVSVDPNNGCQRCHFCHSGQPHFCKIGGINNTIGIFRDGGWANYAVAPEEQV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_45907

• Blastp: L-threonine 3-dehydrogenase from Streptomyces with 38.24% of identity
• Blastx: L-threonine 3-dehydrogenase from Streptomyces with 38.24% of identity
• Eggnog: Dehydrogenase(COG1063)
• Kegg: Link to kegg annotations (SAV_1628)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020999286.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;