| Transcript | Ll_transcript_45921 |
|---|---|
| CDS coordinates | 40-396 (-) |
| Peptide sequence | YKKIKEWENQIRDETESFWVMRNDLRRERKLPGYLDREVFDILGAESPAAAAEAAAAEQVAADVEVHIYDSNRRVGSDDGLFSDTERDEVLVVKDVPAPVPISGLVSCIIFCITFCCL* |
| ORF Type | 5prime_partial |
| Blastp | Trihelix transcription factor ASR3 from Arabidopsis with 48.89% of identity |
|---|---|
| Blastx | Trihelix transcription factor ASR3 from Arabidopsis with 74.42% of identity |
| Eggnog | NA(ENOG410YBJK) |
| Kegg | Link to kegg annotations (AT2G33550) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451105.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer