Protein coding transcript 132037

• Transcript: Ll_transcript_45913
• CDS coordinates: 2-439 (+)
• Peptide sequence: GMSEQELEEIMSRNRTVSSSAIARAVADAAAGEFSSAIETLVTAISLIKQSKVASDERCKILVSSLHDTLHGIESKSYSSRRERSRSPRDRLHRRSRRERTRSRERDYRDRSRERDRDRERDRDKYVDRYYTTERDGDRDREIREK
• ORF Type: internal

Annotations of Ll_transcript_45913

• Blastp: Cleavage and polyadenylation specificity factor subunit 6 from Danio with 63.03% of identity
• Blastx: Cleavage and polyadenylation specificity factor subunit CG7185 from Sophophora with 85.33% of identity
• Eggnog: RRM(ENOG41101FF)
• Kegg: Link to kegg annotations (327069)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;