Transcript | Ll_transcript_45901 |
---|---|
CDS coordinates | 1-411 (+) |
Peptide sequence | IDVIDRQVINGELHSHRLVTTRWTLPNWACALMGPISTFYASEYSKVNRDRRQLKLDSQNLSLGPFVIVREKLTYKPHPDDPQKTLLKQTAYVTVEGLPCSGYIENILTSKISGNAAKGRQAIEWVIEKLQHKQPL* |
ORF Type | 5prime_partial |
Blastp | Protein slowmo from Sophophora with 52.38% of identity |
---|---|
Blastx | Protein slowmo from Sophophora with 52.38% of identity |
Eggnog | Slowmo homolog(ENOG410YBNZ) |
Kegg | Link to kegg annotations (Dmel_CG9131) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020224370.1) |
Pfam | PRELI-like family (PF04707.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer