Protein coding transcript 132043

• Transcript: Ll_transcript_45960
• CDS coordinates: 97-528 (+)
• Peptide sequence: MASFTTGMSSHTRKVQTLYKKAVRSLENWYDRRDVFRYQAVLMRERFDQNKDVKDMRIAKDLIMKGEQELFEKQHWHPKKFPESPGGVAYGREVIPPDWVMDYWHPIEKAQYPEYFARREQRKQEYIKLWEKTHGKPTTTGHH*
• ORF Type: complete

Annotations of Ll_transcript_45960

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 from Bos with 47.41% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 from Bos with 47.76% of identity
• Eggnog: NADH dehydrogenase (ubiquinone) 1 beta subcomplex(ENOG4111PES)
• Kegg: Link to kegg annotations (327660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415785.1)
• Pfam: Complex 1 protein (LYR family) (PF05347.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;