Protein coding transcript 132047

• Transcript: Ll_transcript_45944
• CDS coordinates: 3-674 (+)
• Peptide sequence: KMSILLALFLFGFVFDLTRAIQLGNCAPSSTIYSKLACENEKMVISCPKNTTIKMETAQYGRTRTDICVGQSQNNSCIDISSHCILEHVCSGKNECIISANNDLFGDPCPNTYKYLEAKYCCEPPYPAGCDTVPQVETSCSTKVLSLTCQVGTVNVLSANYGRTDSTTCPYGPIKTTNCRADNTTKIVSERCNGKGSCDVLADHRVFGDPCYGTFKYLTTKFCC
• ORF Type: internal

Annotations of Ll_transcript_45944

• Blastp: L-rhamnose-binding lectin CSL3 from Oncorhynchus with 37.62% of identity
• Blastx: L-rhamnose-binding lectin CSL3 from Oncorhynchus with 37.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004512085.1)
• Pfam: Galactose binding lectin domain (PF02140.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;