Protein coding transcript 132048

• Transcript: Ll_transcript_45918
• CDS coordinates: 2-328 (+)
• Peptide sequence: IEIVAHGLLAHGVTSFCPTLVTSRPEVYQTVLPKLKPTQGGQHGASILGAHLEGPFINKLKKGAHEESAITDLKEGPKSLLDVYGSVENACIVTLAPELPGATDVTEWL
• ORF Type: internal

Annotations of Ll_transcript_45918

• Blastp: N-acetylglucosamine-6-phosphate deacetylase from Mus with 52.73% of identity
• Blastx: N-acetylglucosamine-6-phosphate deacetylase from Mus with 52.73% of identity
• Eggnog: GlcNAc 6-P deacetylase(COG1820)
• Kegg: Link to kegg annotations (245847)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013442306.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;