Transcript | Ll_transcript_45918 |
---|---|
CDS coordinates | 2-328 (+) |
Peptide sequence | IEIVAHGLLAHGVTSFCPTLVTSRPEVYQTVLPKLKPTQGGQHGASILGAHLEGPFINKLKKGAHEESAITDLKEGPKSLLDVYGSVENACIVTLAPELPGATDVTEWL |
ORF Type | internal |
Blastp | N-acetylglucosamine-6-phosphate deacetylase from Mus with 52.73% of identity |
---|---|
Blastx | N-acetylglucosamine-6-phosphate deacetylase from Mus with 52.73% of identity |
Eggnog | GlcNAc 6-P deacetylase(COG1820) |
Kegg | Link to kegg annotations (245847) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013442306.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer