Transcript | Ll_transcript_45870 |
---|---|
CDS coordinates | 58-717 (+) |
Peptide sequence | MAENNVVLLDFWPSSYGMRVKIALAETGVSYECKQEDFQAKSSLLLEMNPVHKMIPVLIHNGKSISESLNIVEYIDEVWNHKHSLLPSDPYKRSQARFWGDFIDKNVYSIGKRVWTVKGEEQELGKKQFIECLKKLEEVLGDNPYFGGENFGYVDVALIPFTSWFYTYETFGNLSIEAECPKLVGWAKRCIEKESVAKSLPHPHKIYEFALEYKQRHGF* |
ORF Type | complete |
Blastp | Probable glutathione S-transferase parA from Nicotiana with 69.86% of identity |
---|---|
Blastx | Probable glutathione S-transferase parA from Nicotiana with 69.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107772524) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418295.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF02798.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer