Protein coding transcript 132053

• Transcript: Ll_transcript_133859
• CDS coordinates: 1-582 (+)
• Peptide sequence: KVEPEKPFQTPAPNAYKSDLPESAPRYSFGVKVEPEKPFQTPAPNVYNTDIPDSAPRYSFGVKVEGEKPFETPAPNVYNVQKSDILLHDHSPQYSFGNKCQVEKPMDTPGPNVYQIPSVVCAPAYTISGRNKEPIDERVKNPGPGQYNNVDPESYKAEHSPAYTISGRTNIPRDDSIPGPGIYSPEKVCIDYPP
• ORF Type: internal

Annotations of Ll_transcript_133859

• Blastp: Outer dense fiber protein 3 from Silurana with 35.53% of identity
• Blastx: Outer dense fiber protein 3 from Silurana with 35.53% of identity
• Eggnog: outer dense fiber of sperm tails(ENOG410YZ5M)
• Kegg: Link to kegg annotations (548547)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015965333.1)
• Pfam: Sperm-tail PG-rich repeat (PF07004.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;