Protein coding transcript 132055

• Transcript: Ll_transcript_133916
• CDS coordinates: 102-593 (+)
• Peptide sequence: MAEEEENANSTKPEFPTGRIKRIMRLDNEVNRVSGEALFLVTRSTELFLQFLADKSARVAIEKKRKIVTLEHLTIAVKRHQPTSDFLLDSLPRAEEKIAPPSNRSSKAEKSPPRSNRRIDQFFKKQVKEPDSDSEAEAETEPEAEAEAEAELEAEAPVPIGEC*
• ORF Type: complete

Annotations of Ll_transcript_133916

• Blastp: Dr1-associated corepressor from Rattus with 29.13% of identity
• Blastx: Dr1-associated corepressor homolog from Dictyostelium with 34.15% of identity
• Eggnog: protein 1 (negative cofactor 2 alpha)(COG5247)
• Kegg: Link to kegg annotations (293674)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417769.1)
• Pfam: Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;