Protein coding transcript 132065

• Transcript: Ll_transcript_133803
• CDS coordinates: 123-833 (+)
• Peptide sequence: MEFPIHLQKSLVPIREMLGKEGERRLSKIGMEQMLVSMGHQSCGAVALWNYPTWMRNLIVHDIDGEDRSDPVDMASMEVYRDREREVARYNEFRRNLLMIPISKWEDLTNEEEVIEVLKEVYGDDIEKLDLIVGLQAEKKIKGFAISETAFFIFLTMASRRIEADRFFTSNFNSQTYTDKGLEWVNRTESLKDVIDRHYPEMTKKWMRCSSAFSVWDSIPDPTNYIPLYLRPAPKQ*
• ORF Type: complete

Annotations of Ll_transcript_133803

• Blastp: Alpha-dioxygenase 2 from Arabidopsis with 72.2% of identity
• Blastx: Alpha-dioxygenase 2 from Arabidopsis with 72.2% of identity
• Eggnog: prostaglandin G H synthase and cyclooxygenase(ENOG410XPZ3)
• Kegg: Link to kegg annotations (AT1G73680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420401.1)
• Pfam: Animal haem peroxidase (PF03098.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;