Transcript | Ll_transcript_133834 |
---|---|
CDS coordinates | 3-341 (+) |
Peptide sequence | EFKGTLYFTFNTKEEAEKFLKLESVKYKDVELERKWEKDFLEEKKKEYEDKLAKKDEKIKAETEKYFKKGYLLKVDNVDASVTVESIKAICVEFEWQVAFVKIVENEKLAWIR |
ORF Type | internal |
Blastp | La protein homolog from Sophophora with 32.17% of identity |
---|---|
Blastx | - |
Eggnog | La ribonucleoprotein domain family member(COG5193) |
Kegg | Link to kegg annotations (Dmel_CG10922) |
CantataDB | - |
Mirbase | - |
Ncbi protein | - |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer