Transcript | Ll_transcript_183377 |
---|---|
CDS coordinates | 2-508 (+) |
Peptide sequence | KRLMVSLCTANRDENSEIDLAQAQADAEALLNAGENQWGTDESTFNMILVSRSYAHLPQVFKEYERLADHDIEKAIKREFAGSMEDGFLSIVKCVKDKTAYFAERLHDAMAGAGTNDRTLIRIIVARSEIDLGDVKEAYYRLYEKTLEDRIESDCSGDYKKLLITLVA* |
ORF Type | 5prime_partial |
Blastp | Annexin B9 from Sophophora with 64.29% of identity |
---|---|
Blastx | Annexin B9 from Sophophora with 64.29% of identity |
Eggnog | annexin A7(ENOG410XPUN) |
Kegg | Link to kegg annotations (Dmel_CG5730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004513341.1) |
Pfam | Annexin (PF00191.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer