Transcript | Ll_transcript_133883 |
---|---|
CDS coordinates | 142-1488 (+) |
Peptide sequence | MVPMKSSIATFSLYISIILLLLNLVLCETESEGRENECKKRWIYIRKLPPRFNLDLLGKCSEYPLLDNFCPYLANHGLGQKTHNRSHSWYRTDPLMLELIFHRRMLEYPCLTQDPFSADAVYLPYYATLDALRYLYGTEVNSSADHGLELFDFLQDDEPSIWNRRNGHDHFLVMARPAWDFSQPLDNDPPLWGTSFLELPELFNLTALTLESRAWPWQEHAVPYPTSFHPPNLGLLESWVQRVQRSKRSALALFVGGGGVSATPNIRRSIRSECDNSTSNSTDVGGGYEKLCEVVDCSNGVCEHDPLRFMKPMLQASFCLQPPGDTPTRRSTFDSIIAGCIPVFFEDLSARSQYGWHLPDSEFDGFSVFIAKEDVVFKGLRILDVLRRIPRSRVRRMREKVMELIPRVVYRKHNSSPGLRAKKDAFDIAVDGTLDKIQSRLKELVLPL* |
ORF Type | complete |
Blastp | Probable xyloglucan galactosyltransferase GT19 from Arabidopsis with 64.99% of identity |
---|---|
Blastx | Probable xyloglucan galactosyltransferase GT19 from Arabidopsis with 64.99% of identity |
Eggnog | Exostosin(ENOG410XTFH) |
Kegg | Link to kegg annotations (AT4G22580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450998.1) |
Pfam | Exostosin family (PF03016.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer