Protein coding transcript 132081

• Transcript: Ll_transcript_236007
• CDS coordinates: 3-722 (+)
• Peptide sequence: TIEIERDKERRKKVKFMASSNSPCAACKFLRRKCQPECAFAPYFPPDQPQKFANVHRIFGASNVTKLLNDLHPHQREDAVNSLAYEAEMRLRDPVYGCVGVISLLQHQLRQLQMDLYCAKSELSRYQNLNIATNHGGICAESAPTTTTYHNPYNNNNTGSVNNGGGRYNHHHHHHQFLPRDQYQHRQQQIVRSIDSGNSYDASLLAMNISASLGNLNQFQQHAAAANGGGNDRGAVNPS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236007

• Blastp: LOB domain-containing protein 6 from Arabidopsis with 59.38% of identity
• Blastx: LOB domain-containing protein 6 from Zea with 82.57% of identity
• Eggnog: lob domain-containing protein(ENOG4111S1U)
• Kegg: Link to kegg annotations (AT1G65620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434726.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;