Protein coding transcript 132087

• Transcript: Ll_transcript_235966
• CDS coordinates: 3-863 (+)
• Peptide sequence: IITGGGTMKLLFKTLCDNDHSLTCNSHLLTGAEWFLVFTCLAILMAQLPNLNSVAYVSLIGGVSAITYCTLFWTLSVRNGRPTSVSYTTSLSKDHSAVANITAIINAIGVIVVAFRGHNVMLEIQGTLHSNLEETSEKPMLRGVIIAYILIAICIFPLAILGFWAYGNHMNGGLLTAFPLHREQVSKFTMGAVYVLLIIHCLTSFQVYAMPVFDNLEIRYTLIKNHRCPRLVRTCIRIFFGGLTFFIAVTFPFLPSLSLLLGGMTLVPITYAYPCFMWLAIKKPRKK
• ORF Type: internal

Annotations of Ll_transcript_235966

• Blastp: Lysine histidine transporter-like 8 from Arabidopsis with 48.61% of identity
• Blastx: Lysine histidine transporter-like 8 from Arabidopsis with 47.57% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT1G47670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450908.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;