Protein coding transcript 132091

• Transcript: Ll_transcript_236003
• CDS coordinates: 2-487 (+)
• Peptide sequence: GSKVLYLGAASGTTVSHVSDVVGPEGLVYAVEFSHRSGRDLINVAKKRTNIIPIIEDARHPHKYRMLIGMVDTIFADVAQPDQARIVSINAQYFLKNEGHFVISIKANCIDSTAEPAAVFAQEIEKLKTDKLKPTEQLTLEPYERDHAVVVGVFRPVPKGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236003

• Blastp: rRNA 2'-O-methyltransferase fibrillarin from Sophophora with 88.68% of identity
• Blastx: rRNA 2'-O-methyltransferase fibrillarin from Sophophora with 88.68% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dere_GG20072)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187361.1)
• Pfam: Fibrillarin (PF01269.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;