Protein coding transcript 132092

• Transcript: Ll_transcript_236004
• CDS coordinates: 3-422 (+)
• Peptide sequence: RFSGGGGRGGFGGGGRGGGGGRGGGGGFRGRGAGGRGGGGRGGGGRPSGGPGGFKGGKKVIIEPHRHAGVFVARGKEDALVTKNMIPGETIYGEKRISVDQTEGDKIEYRVWNPFRSKLAAAILGGIDEIHMPPGSKVLY
• ORF Type: internal

Annotations of Ll_transcript_236004

• Blastp: Probable mediator of RNA polymerase II transcription subunit 36b from Arabidopsis with 74.71% of identity
• Blastx: rRNA 2'-O-methyltransferase fibrillarin from Schizosaccharomyces with 74.39% of identity
• Eggnog: Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in rRNA and tRNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA (By similarity)(COG1889)
• Kegg: Link to kegg annotations (AT5G52470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013452174.1)
• Pfam: Fibrillarin (PF01269.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;