| Transcript | Ll_transcript_235956 |
|---|---|
| CDS coordinates | 348-728 (+) |
| Peptide sequence | MKKFIDCSGIQPYKCNSKWVISLNPLPHNGSAVNYEALCTICSRKLTEPHKYSYCSISCKVKAVLEKPNDSLPPFISIQSPSHETQEETSEPQMEEATEQQNEETSKPQSLRKRRRKGTPHRAPFF* |
| ORF Type | complete |
| Blastp | Uncharacterized protein At3g50808 from Arabidopsis with 31.01% of identity |
|---|---|
| Blastx | Uncharacterized protein At3g50808 from Arabidopsis with 31.01% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT3G50808) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461638.1) |
| Pfam | PLATZ transcription factor (PF04640.13) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer