Transcript | Ll_transcript_236026 |
---|---|
CDS coordinates | 58-732 (+) |
Peptide sequence | MATTTTPFITLSPKTLTLPYHQKTTALISFLRNNVGVGSNAIRSRSRSRIRAAIDGEYSSKRSSSSEQRETIMLPGCDYNHWLIVMEFPKDPAPTRDQMIETYLNTLATVLGSIQEAKKNMYAFSTTTYTGFQCTVDEATSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYINGEIIPSKYPTYQPKRGGPKNESRRYERRRDGPPPERRRPKQETTASDSTST* |
ORF Type | complete |
Blastp | Multiple organellar RNA editing factor 9, chloroplastic from Arabidopsis with 77.44% of identity |
---|---|
Blastx | Multiple organellar RNA editing factor 9, chloroplastic from Arabidopsis with 90.3% of identity |
Eggnog | DAG protein(ENOG410YD5Z) |
Kegg | Link to kegg annotations (AT1G11430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440308.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer