Protein coding transcript 132102

• Transcript: Ll_transcript_235939
• CDS coordinates: 105-707 (+)
• Peptide sequence: MGSKREKLEALVYWRDPISSGIVFGATLVVLLSFAYMSLISVVAYLAMFIQSACILLRLYKTALQTVNKTNESHPFQEYLDLDIRLPQEKAEEVSKLAVVHVNAVLVELRRLLLAEDLVDSAKFFGILWVLTYVGALFNGLTLIIIGFVALFTLPKVYENNKTQIDQNIEVVRSKIAELTNKVRAAIPIGKKNPETKKKE*
• ORF Type: complete

Annotations of Ll_transcript_235939

• Blastp: Reticulon-1-A from Xenopus with 49.19% of identity
• Blastx: Reticulon-3-A from Xenopus with 45.51% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (496390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452780.1)
• Pfam: Reticulon (PF02453.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;