Protein coding transcript 132104

• Transcript: Ll_transcript_236052
• CDS coordinates: 59-397 (-)
• Peptide sequence: PALVAADVGMAIGAGTDIAIEAADIVLVKSSLEDVVTAIDLSRKSMSRIRLNYIWALGYNILGMPIAAGVLYPFTGIRLPPWLAGACMAASSLSVVSSSLLLQFYKKPLHID*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_236052

• Blastp: Copper-transporting ATPase HMA4 from Oryza sativa with 84.82% of identity
• Blastx: Copper-transporting ATPase HMA4 from Oryza sativa with 84.82% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (4328616)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463226.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;