Protein coding transcript 132108

• Transcript: Ll_transcript_236008
• CDS coordinates: 51-341 (+)
• Peptide sequence: MRRPPPSVPPPPPLIPSQPSRIDSSIWRACAGASVQIPVVNSRVYYFPQGHLDQASSPPEQLSSNVYSNPCVLCRIVDVQFLADHKTDEVFVKLVLH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_236008

• Blastp: Auxin response factor 10 from Arabidopsis with 50.63% of identity
• Blastx: Auxin response factor 10 from Arabidopsis with 52.7% of identity
• Eggnog: auxin response factor(ENOG410ZZ2C)
• Kegg: Link to kegg annotations (AT2G28350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414370.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;