Protein coding transcript 132109

• Transcript: Ll_transcript_235943
• CDS coordinates: 2-325 (+)
• Peptide sequence: GQATLGNTIMKSNVKKIRSLYHEKVIAGFAGGTADAFTLFEMFDKKLAMYQGQLQRAAIELAKDWRSDRMLRKLEALLAVADKKTSLIITGNGDVIQPEDDLIAIGSG
• ORF Type: internal

Annotations of Ll_transcript_235943

• Blastp: ATP-dependent protease subunit HslV from Buchnera with 100% of identity
• Blastx: ATP-dependent protease subunit HslV from Buchnera with 100% of identity
• Eggnog: Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery (By similarity)(COG5405)
• Kegg: Link to kegg annotations (BU578)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434058.1)
• Pfam: Proteasome subunit (PF00227.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;