Transcript | Ll_transcript_235974 |
---|---|
CDS coordinates | 182-1129 (+) |
Peptide sequence | MCFFPPHCFSIYFALILVLLCIDKGAIGATFTLINKCDYTVWPGILANVGSSGLGATGFELLPSGSRSFQAPSNWSGRIWGRTGCNFDPNTQQGTCTTGDCGSNQMSCNGAGASPPATLAEFTIGSGTQDFYDMSLVDGYNLPMIIDPHGGTGACGSTGCVTDLNQQCPNELRVRDGVACKSACEVFRSPEYCCSGAYASPTTCKPSVYSEIFKSACPKSYSYAYDDATSTFTCTGADYTITFCPSTTSQKSARDSAAAAAPPPAIGSETRTGEIPLIVNSPWFSNFFTGLSSKTHSSASSFIFTLIILIFLSLQ* |
ORF Type | complete |
Blastp | Pathogenesis-related protein 5 from Arabidopsis with 57.45% of identity |
---|---|
Blastx | Pathogenesis-related protein 5 from Arabidopsis with 54.89% of identity |
Eggnog | thaumatin-like protein(ENOG4111KEV) |
Kegg | Link to kegg annotations (AT1G75040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449455.1) |
Pfam | Thaumatin family (PF00314.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer