Protein coding transcript 132111

• Transcript: Ll_transcript_235974
• CDS coordinates: 182-1129 (+)
• Peptide sequence: MCFFPPHCFSIYFALILVLLCIDKGAIGATFTLINKCDYTVWPGILANVGSSGLGATGFELLPSGSRSFQAPSNWSGRIWGRTGCNFDPNTQQGTCTTGDCGSNQMSCNGAGASPPATLAEFTIGSGTQDFYDMSLVDGYNLPMIIDPHGGTGACGSTGCVTDLNQQCPNELRVRDGVACKSACEVFRSPEYCCSGAYASPTTCKPSVYSEIFKSACPKSYSYAYDDATSTFTCTGADYTITFCPSTTSQKSARDSAAAAAPPPAIGSETRTGEIPLIVNSPWFSNFFTGLSSKTHSSASSFIFTLIILIFLSLQ*
• ORF Type: complete

Annotations of Ll_transcript_235974

• Blastp: Pathogenesis-related protein 5 from Arabidopsis with 57.45% of identity
• Blastx: Pathogenesis-related protein 5 from Arabidopsis with 54.89% of identity
• Eggnog: thaumatin-like protein(ENOG4111KEV)
• Kegg: Link to kegg annotations (AT1G75040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449455.1)
• Pfam: Thaumatin family (PF00314.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;