Protein coding transcript 132114

• Transcript: Ll_transcript_236009
• CDS coordinates: 114-602 (+)
• Peptide sequence: MQKIKLQSSDGEICEVDVDVAKCSVTIKTMLEDLGVNEDEEELVPLPNVNSVILKKVIQWATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTPSEEEQVRKENEWCEEK*
• ORF Type: complete

Annotations of Ll_transcript_236009

• Blastp: S-phase kinase-associated protein 1 from Xenopus with 84.05% of identity
• Blastx: S-phase kinase-associated protein 1 from Xenopus with 84.05% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (380538)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020996771.1)
• Pfam: Skp1 family, tetramerisation domain (PF03931.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;