Protein coding transcript 132116

• Transcript: Ll_transcript_235970
• CDS coordinates: 1-750 (+)
• Peptide sequence: KRMISNTTTVKSCLNNDHKCFTESPISLLQRCKSIKQLKQIQSLIITMGLSSYVAFQNKVIVFCCTMESGDMGYAHKLFDTIAEPSVFIWNTMIKGYSKVNCPQNGVSMYLQMLANDTKPDGFTFPFLLKGFRKDSALRYGKVLLNHAVKHGLLSNLFVQKAFIHVFSLHGMVHMAHKVFDMGGNAASWEVITWNIMISGYNRVKQFEESKKLFIEMEKKGVLPNSVTLVLMLSVCSKLRDLNGGRHIYC
• ORF Type: internal

Annotations of Ll_transcript_235970

• Blastp: Putative pentatricopeptide repeat-containing protein At3g15930 from Arabidopsis with 48.09% of identity
• Blastx: Putative pentatricopeptide repeat-containing protein At3g15930 from Arabidopsis with 48.09% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT3G15930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445114.1)
• Pfam: PPR repeat family (PF13041.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;