Transcript | Ll_transcript_235971 |
---|---|
CDS coordinates | 1-600 (+) |
Peptide sequence | LLGACGVHRNVDIAEMAAKQILELEPENGAAYVLLCNIYAACKQWENVRQVRRTMMEKGIKKTPGCSMMELNGNVYEFVAGDQSHPQSKEIYEKLENMIQDLKYVAGYSPDTSEVFLDIGEEDKETALYRHSEKLAIAYALISSGPGITIRIVKNLRMCVDCHHMAKLVSKAYNRELIVRDKTRFHHFKNGSCSCNNFW* |
ORF Type | 5prime_partial |
Blastp | Pentatricopeptide repeat-containing protein At4g21065 from Arabidopsis with 53.77% of identity |
---|---|
Blastx | Pentatricopeptide repeat-containing protein At4g21065 from Arabidopsis with 53.77% of identity |
Eggnog | Pentatricopeptide repeat-containing protein(ENOG410Z7Z7) |
Kegg | Link to kegg annotations (AT4G21065) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445114.1) |
Pfam | DYW family of nucleic acid deaminases (PF14432.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer