Protein coding transcript 132117

• Transcript: Ll_transcript_235971
• CDS coordinates: 1-600 (+)
• Peptide sequence: LLGACGVHRNVDIAEMAAKQILELEPENGAAYVLLCNIYAACKQWENVRQVRRTMMEKGIKKTPGCSMMELNGNVYEFVAGDQSHPQSKEIYEKLENMIQDLKYVAGYSPDTSEVFLDIGEEDKETALYRHSEKLAIAYALISSGPGITIRIVKNLRMCVDCHHMAKLVSKAYNRELIVRDKTRFHHFKNGSCSCNNFW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_235971

• Blastp: Pentatricopeptide repeat-containing protein At4g21065 from Arabidopsis with 53.77% of identity
• Blastx: Pentatricopeptide repeat-containing protein At4g21065 from Arabidopsis with 53.77% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT4G21065)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445114.1)
• Pfam: DYW family of nucleic acid deaminases (PF14432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;