Protein coding transcript 132121

• Transcript: Ll_transcript_3261
• CDS coordinates: 3-797 (+)
• Peptide sequence: APRYRPTAVEDEEAVDQQESECPEPNGFFADASQCDKYYACSDNKITEKLCPDGMVFNDYSSQQEKCDLPLNIDCSQRPALQTPQPAEHCPRQNGYFAHENQNICDKFYYCVDGKFNAITCPGGLVYNEKSGICTWPDEAKKKGCSSQDVFNFRCPNVTSEIALQHPRYANPEDCQFFYVCVNGDTPRRNGCKMGQVFNEASGKCDWPRNVPECADWYRGVLTDEELYNLENPKPKETTKEKEAAAARRKPSRPPTTKRTVEEDD
• ORF Type: internal

Annotations of Ll_transcript_3261

• Blastp: Protein obstructor-E from Sophophora with 34.78% of identity
• Blastx: Protein obstructor-E from Sophophora with 34.78% of identity
• Eggnog: cuticular protein analogous to peritrophins 3-E(ENOG4111HJZ)
• Kegg: Link to kegg annotations (Dmel_CG11142)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003605045.1)
• Pfam: Chitin binding Peritrophin-A domain (PF01607.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;