| Transcript | Ll_transcript_3328 |
|---|---|
| CDS coordinates | 3-320 (+) |
| Peptide sequence | VPPGAGGIPAGLQGPVRGVGGPSAQVMAPGGRGAQVSAPPQMRPQQPGPPRMPVGGPPPGMMGPPPGMMGMHPGMMGRGAPPMGAPPMRGMPPSMIRGGPPRPPY* |
| ORF Type | 5prime_partial |
| Blastp | Small nuclear ribonucleoprotein-associated protein B from Sophophora with 52.48% of identity |
|---|---|
| Blastx | - |
| Eggnog | small nuclear ribonucleoprotein(COG1958) |
| Kegg | Link to kegg annotations (Dmel_CG5352) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | - |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer