Protein coding transcript 132126

• Transcript: Ll_transcript_3329
• CDS coordinates: 107-469 (+)
• Peptide sequence: MTISKNNKMLQHINYRVRIILQDSRTLIGTFKAFDKHMNLILGDCEEFRKIKPKKKMPEREEKRVLGFVLLRGENIVCMTVEGPPPPEEGLPRVPVPGAAPGPGMGRAAGRGVPPWCWRHS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_3329

• Blastp: Small nuclear ribonucleoprotein-associated protein B from Sophophora with 86.09% of identity
• Blastx: Small nuclear ribonucleoprotein-associated protein B from Sophophora with 79.01% of identity
• Eggnog: small nuclear ribonucleoprotein(COG1958)
• Kegg: Link to kegg annotations (Dmel_CG5352)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003519562.1)
• Pfam: LSM domain (PF01423.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;