Transcript | Ll_transcript_3258 |
---|---|
CDS coordinates | 98-637 (+) |
Peptide sequence | MAEASSREVTRIMVGVNESSIKGYPNPSISSKGAFEWTIHTIVRHNVSAFHLLFLHVQVPDEDGFDDMDSIYASPEDFKNLNQRNRISGTHLLEYFVNRCHEIGVRCEAWTKLGDPKEVICHEVKRVQPDFLVVGSRGLGPFQRVFVGTVSEFCVKHCECPVITIKRKANETPQDPVDD* |
ORF Type | complete |
Blastp | Universal stress protein A-like protein from Arabidopsis with 73.26% of identity |
---|---|
Blastx | Universal stress protein A-like protein from Arabidopsis with 73.26% of identity |
Eggnog | Universal stress protein(ENOG41119AN) |
Kegg | Link to kegg annotations (AT3G01520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451141.1) |
Pfam | Universal stress protein family (PF00582.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer