Protein coding transcript 132131

• Transcript: Ll_transcript_3258
• CDS coordinates: 98-637 (+)
• Peptide sequence: MAEASSREVTRIMVGVNESSIKGYPNPSISSKGAFEWTIHTIVRHNVSAFHLLFLHVQVPDEDGFDDMDSIYASPEDFKNLNQRNRISGTHLLEYFVNRCHEIGVRCEAWTKLGDPKEVICHEVKRVQPDFLVVGSRGLGPFQRVFVGTVSEFCVKHCECPVITIKRKANETPQDPVDD*
• ORF Type: complete

Annotations of Ll_transcript_3258

• Blastp: Universal stress protein A-like protein from Arabidopsis with 73.26% of identity
• Blastx: Universal stress protein A-like protein from Arabidopsis with 73.26% of identity
• Eggnog: Universal stress protein(ENOG41119AN)
• Kegg: Link to kegg annotations (AT3G01520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451141.1)
• Pfam: Universal stress protein family (PF00582.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;