Protein coding transcript 132139

• Transcript: Ll_transcript_3299
• CDS coordinates: 1-540 (+)
• Peptide sequence: GKMNVTKFSTGVVRKSVSLIVKRNLQKSAAAMVKVGDSLPSVDLFEDLPTNKVNLAELSKNKKIIVFAVPGAFTPGCSKTHLPGYVEKADQLKSSGIAEIVCVSVNDPFVMGAWAKDQKTAGKIRMLADPQAQLAKALDLTVEIAPLGGVRSKRYSIVAENGVIKSLQVEPDGTGLSCSL
• ORF Type: internal

Annotations of Ll_transcript_3299

• Blastp: Peroxiredoxin-5, mitochondrial from Homo with 53.99% of identity
• Blastx: Peroxiredoxin-5, mitochondrial from Homo with 53.99% of identity
• Eggnog: peroxiredoxin(COG0678)
• Kegg: Link to kegg annotations (25824)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456847.1)
• Pfam: Redoxin (PF08534.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;