Transcript | Ll_transcript_3361 |
---|---|
CDS coordinates | 2-307 (+) |
Peptide sequence | YMSNHINLGRATGSFSALGAGAGAGASASATSSVPVRPLQQPFDISDYYSSVSTTFSAFKSSDVMEASMGFPFTSAQWKELERQAMVYKYMMASVPVPPDLL |
ORF Type | internal |
Blastp | Growth-regulating factor 8 from Arabidopsis with 55.36% of identity |
---|---|
Blastx | Growth-regulating factor 8 from Arabidopsis with 55.36% of identity |
Eggnog | growth-regulating factor(ENOG41113EA) |
Kegg | Link to kegg annotations (AT4G24150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437326.1) |
Pfam | QLQ (PF08880.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer