Protein coding transcript 132140

• Transcript: Ll_transcript_3361
• CDS coordinates: 2-307 (+)
• Peptide sequence: YMSNHINLGRATGSFSALGAGAGAGASASATSSVPVRPLQQPFDISDYYSSVSTTFSAFKSSDVMEASMGFPFTSAQWKELERQAMVYKYMMASVPVPPDLL
• ORF Type: internal

Annotations of Ll_transcript_3361

• Blastp: Growth-regulating factor 8 from Arabidopsis with 55.36% of identity
• Blastx: Growth-regulating factor 8 from Arabidopsis with 55.36% of identity
• Eggnog: growth-regulating factor(ENOG41113EA)
• Kegg: Link to kegg annotations (AT4G24150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437326.1)
• Pfam: QLQ (PF08880.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;