Protein coding transcript 132141

• Transcript: Ll_transcript_3310
• CDS coordinates: 71-424 (+)
• Peptide sequence: MDSAQHVISIEPEKQSLLNKHTEKHFTAGDAVRDIIIGVSDGLTVPFALAAGLSGANATSAIVLTAGIAEVAAGAISMGLGGYLAAKSEADHYDRELRREQEEIVTVPDTGLHSVLF*
• ORF Type: complete

Annotations of Ll_transcript_3310

• Blastp: Vacuolar iron transporter 1 from Arabidopsis with 87.38% of identity
• Blastx: Vacuolar iron transporter 1 from Arabidopsis with 87.38% of identity
• Eggnog: integral membrane protein(COG1814)
• Kegg: Link to kegg annotations (AT2G01770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446201.1)
• Pfam: VIT family (PF01988.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;