| Transcript | Ll_transcript_3352 |
|---|---|
| CDS coordinates | 1-300 (+) |
| Peptide sequence | ILAVLTLWYGLAKAENQQLDIQNKYFNTPTVRLGLLAGVLLLQMYLVFNVISKEMAKSRESKSLTTVSKNKTQKKEKSKKNKKGASEESDLPEVDQNTNK |
| ORF Type | internal |
| Blastp | Translocating chain-associated membrane protein 1-like 1 from Xenopus with 36.14% of identity |
|---|---|
| Blastx | Translocating chain-associated membrane protein 1-like 1 from Xenopus with 39.68% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (446460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | - |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer