Transcript | Ll_transcript_3308 |
---|---|
CDS coordinates | 39-359 (+) |
Peptide sequence | MKYTILVTFAAVCLSNAIVCVAEQSLFSESQRNEIRDICATLTKGSPGLDGLPGFSGDSGLPGPIGPPGLPGLPGLMGFSGIRGLPGIKGEPGLPGLPGEKGAKGDL |
ORF Type | 3prime_partial |
Blastp | Collagen alpha-2(IV) chain from Ascaris with 56.94% of identity |
---|---|
Blastx | - |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003621422.1) |
Pfam | Collagen triple helix repeat (20 copies) (PF01391.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer