Protein coding transcript 132155

• Transcript: Ll_transcript_183358
• CDS coordinates: 70-522 (+)
• Peptide sequence: MENYTSDSSDSENNGKVLDYAYLLMNSETVENRFDTVIKDPKKSHLDVENIILHHNQLNLLPVNLNKFSNMKVLDVSNNGLTILPDVFEYCSLTTLIAKNNSLSNDSLPKSFNNTSTLRELNLNGNQITNFPEQILEFTNLKFLYLGGNGM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_183358

• Blastp: Leucine-rich repeat-containing protein 58 from Homo with 29.81% of identity
• Blastx: Leucine-rich repeat-containing protein 58 from Homo with 29.81% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (116064)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421957.1)
• Pfam: Leucine rich repeats (6 copies) (PF13306.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;