Protein coding transcript 132156

• Transcript: Ll_transcript_183359
• CDS coordinates: 2-388 (+)
• Peptide sequence: FISKNIYKLQSLQVLSFGGNNLTEVPATLGHLKHLYALILCDNKLEGLPANIANLHNLKSLMLHKNHLRTLPPEIVALKNLTELSLRENPLVVRFVSDMSYNPGSLLELSARSVKSHNMDVKPGDVPLT
• ORF Type: internal

Annotations of Ll_transcript_183359

• Blastp: Leucine-rich repeat-containing protein 58 from Homo with 51.59% of identity
• Blastx: Leucine-rich repeat-containing protein 58 from Homo with 51.59% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (116064)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015961280.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;