Protein coding transcript 132158

• Transcript: Ll_transcript_95184
• CDS coordinates: 150-734 (+)
• Peptide sequence: MSTTIIVPESRNIVKGKTVVLGNPRAGGMKKGIAIMDFILRLGAIAASLGAAASMGTSDQTLPFFTQFFQFEASYDSFSAFQFFVITMALVAGYLVLSLPFSIVSIIRPHATGPRLFLIILDTVFLTLATASAASAAAIVYLAHNGNQDSNWLAICNQFGDFCAQTSGAVVSSLVAVVIFVLLIVMSALALKKT*
• ORF Type: complete

Annotations of Ll_transcript_95184

• Blastp: Casparian strip membrane protein 3 from Soja with 87.18% of identity
• Blastx: Casparian strip membrane protein 3 from Soja with 87.63% of identity
• Eggnog: cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion(ENOG411190Z)
• Kegg: Link to kegg annotations (100500387)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020210673.1)
• Pfam: Domain of unknown function (DUF588) (PF04535.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;