Protein coding transcript 132161

• Transcript: Ll_transcript_95204
• CDS coordinates: 127-621 (+)
• Peptide sequence: MKEGGRKQGAMSPCAACKLLRRRCAQDCVFAPYFPANQPQKFASVHKVFGASNVNKMLQELPEQQRGDAVKSMVYEANARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAEVVHMKMHQATTSLDHDQPPMHVASNSSSQTKSFFAMDLVVDKANMGESLWSC*
• ORF Type: complete

Annotations of Ll_transcript_95204

• Blastp: LOB domain-containing protein 4 from Arabidopsis with 68.02% of identity
• Blastx: LOB domain-containing protein 4 from Arabidopsis with 68.02% of identity
• Eggnog: lob domain-containing protein(ENOG410YHFG)
• Kegg: Link to kegg annotations (AT1G31320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432352.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: -